Suche nach calcium factor:
25 Ergebnisse
-
IAMG :: Article Browser
... analysis; kinematics-; diffusion-; iron-; manganese-; olivine-; olivine-group; nesosilicates-; orthosilicates-; silicates-; lunar-crust; Moon-; reaction-rims; pyroxene-group; chain-silicates; calcium-; time-factor; chemical-composition; computer-programs; Fortran-; finite-difference-analysis; Crank-Nicholson-method CC: 02-Geochemistry AN: 83-57889 TI: A ...
http://www.iamg.org/index.php/publisher/articleview/frmArticleID/85
-
http://mendel.imp.ac.at/Pombe_tagging/genedb_25_11_08/sysID2product.txt
... mug65 spore wall assembly protein (predicted)
SPAC1296.02 cox4 cytochrome c oxidase subunit IV (predicted)
SPBC23E6.07c rfc1 DNA replication factor C complex subunit Rfc1
SPBC21C3.16c spt4 transcription elongation factor complex subunit Spt4
SPAC19G12.07c rsd1 RNA-binding protein Rsd1
SPAC22E12.11c set3 histone lysine methyltransferase Set3
SPAC3A12.17c cys12 ... oxysterol binding protein (predicted)
SPBP8B7.11 nxt3 ubiquitin protease cofactor (predicted)
SPBP8B7.13 conserved fungal protein
SPAC15A10.02 taf12 transcription factor TFIID complex subunit A/ SAGA complex subunit (predicted)
SPBC3B9.21 dcp1 mRNA decapping complex subunit Dcp1
SPAC15A10.01 ... ...
http://mendel.imp.ac.at/Pombe_tagging/genedb_25_11_08/sysID2product.txt
-
Microsoft Word - Publikationsliste Moroni C.doc
... V., and Moroni, C. (1996). Impaired interleukin-3
mRNA decay in autocrine mast cell tumors after transient calcium ionophore
stimulation. Growth Factors 13, 99-110.
Nakagawa, J., Waldner, H., Meyer-Monard, S., Hofsteenge, J., Jeno, P., and ... A., Nair, A.P., and Moroni, C. (1991). Ras
oncogenes amplify lymphokine (interleukin 3, granulocyte-macrophage
colony-stimulating factor) induction by calcium ionophore. Oncogene 6, 2327-
2332.
Wodnar-Filipowicz, A., and Moroni, C. (1990). Regulation of interleukin ... ...
http://www.biozentrum.unibas.ch/guest_professor/moroni/documents/Publikationsliste_Moroni_C.pdf
-
http://mendel.imp.ac.at/SEQUENCES/GACKIX/blast_kix/AAB31182.psi
... ref|XP_300582.1| similar to KIAA0970 protein [Homo sapiens] 30 5.4
sp|O24744|RPSD_SHEVI RNA polymerase sigma factor rpoD (Sigma-70)... 30 5.4
ref|NP_229608.1| conserved hypothetical protein [Thermotoga mari... 30 5.9
ref|NP_348680.1 ...
http://mendel.imp.ac.at/SEQUENCES/GACKIX/blast_kix/AAB31182.psi
-
Publikationen
... for Viral Interleukin-6 as Inhibitors of the vIL-6 - gp130 Interaction. The transcription factor repertoire of Flt3+ hematopoietic stem cells. The transcription factor Interferon regulatory factor-4 controls experimental colitis via T cell derived interleukin-6. The transcription factor NFATc2 controls IL-6-dependent T cell activation in experimental colitis. TLR-ligand induced podosome disassembly is ADAM17 ... and controlled development of mouse dendritic cells from Flt3+ CD11b+ progenitors in vitro. Soluble tumor necrosis factor ...
http://www.univis.uni-kiel.de/formbot/dsc_3Danew_2Fpub_26dir_3Dmedizi_2Fbioche_2Fzytoki_26ref_3Dpub_26years_3Dall
-
Impact Theory of Mass Extinction I
... did their calculations only on the basis of leaching out all of the calcium carbonate from the samples, so they would only be measuring clay. Ir was up by more than an ...
http://rainbow.ldeo.columbia.edu/courses/v1001/impact23.html
-
Lecture 23 - Impact Theory of Mass Extinction
... did their calculations only on the basis of leaching out all of the calcium carbonate from the samples, so they would only be measuring clay. Ir was up by more than an ...
http://rainbow.ldeo.columbia.edu/courses/v1001/23.html
-
Publications - Biomedical Technology - Danube University Krems
Publications - Biomedical Technology - Danube University Krems HOME SITEMAP CONTACT LIBRARY DEUTSCH ENGLISH About Mission Statement Facts and Figures Organigram DUK-Gesetz Chronicle Imagefilm Rectorate Rector Vice Rector University Director Rector´s Office Boards University Council Senate Commitee for Equality Issues Arbitration Commission Departments Arts and Management Building and Environment Clinical Medicine and Biotechnology Clinical Medicine and Preventive Medicine Continuing Education Research and Educational Management European Integration and Business Law Evidence Based Medicine and Clinical Epidemiology Governance and Public Administration ...
http://www.donau-uni.ac.at/en/department/kmbt/publikationen/biomedizinischetechnologie/index.php
-
1752-0509-3-58.fm
BioMed Central
BMC Systems Biology
Open Access
Software
ChemChains: a platform for simulation and analysis of biochemical
networks aimed to laboratory scientists
Tomáš Helikar
1
and Jim A Rogers*
1,2
Address:
1
Department of Pathology and Microbiology, University of Nebraska Medical Center, 983135 Nebraska Medical Center, Omaha, NE
68198, USA and
2
Department of Mathematics, University of Nebraska, 6001 Dodge Street, Omaha, NE 68182, USA
Email: Tomáš Helikar - thelika@unmc.edu; ...
http://www.biomedcentral.com/content/pdf/1752-0509-3-58.pdf
-
Skript Knochen-Stoffwechsel
... von Zytokinen kann die Differenzierung dieser Vorläuferzellen zu Osteoklasten auslösen. Das einfachste Signalmuster besteht aus M-CSF ( macrophage colony stimulating factor ) und RANKL (erklärt im Abschnitt Parathormon), die beide von Osteoblasten gebildet werden. Doch auch Zytokine, die im Rahmen von Entzündungen ... entstehen große Teile des Schädels; auch die Heilung von Knochenbrüchen erfolgt auf diesem Weg. 2. REGULATION DES KNOCHENSTOFFWECHSELS 2.1 Calcium- und Phosphat-Haushalt 2.1.1 Lösliches Ca 2+ , Hydroxylapatit und Calcitonin Calcium (Ca 2+ ) ist im Körper in riesigen Mengen enthalten, da es ein Hauptbestandteil unserer Knochen ist. Andererseits feinregulieren ...
http://arno.helmberg.at/knochen-stoffwechsel.htm
-
http://poggiolab.unibas.ch/full/poggioCV.pdf
MARTINO POGGIO
Univeristy of Basel Office: 3.15
Department of Physics Tel.: +41 61 267 37 61
Klingelbergstrasse 82 Fax: +41 61 267 37 95
CH-4056 Basel Email: martino.poggio@unibas.ch
Switzerland Web: poggiolab.unibas.ch
Curriculum Vitae
Background
Birth 5th of March, 1978 in Tübingen, Germany
Citizenship Italy, USA (dual)
Languages Italian, English, some French
Education
Dec. 2005 Ph.D in Physics, University of California, Santa Barbara
Dec. 2003 M.A. in Physics, University of California, Santa Barbara
Jun. 2000 A.B. ...
http://poggiolab.unibas.ch/full/poggioCV.pdf
-
http://mendel.imp.ac.at/SEQUENCES/GACKIX/blast_kix/CTV22.psi
Hits in CTV22 with E < 0.01
######SEQUENCE
GESNLDTGDWRTQLQPDSRQRIVNKIMDTLKRHLPFSGQDGLNELKKIAGRFEEKIYTAA
SSQSDYLRKISLKMLSMESKSQNAMPNSLQSNNPGSSNRPPDPGSMQNQVHNQGQSLPIP
LSANQSQVRQQLLSQ
######COMMAND
blastpgp -i CTV22 -F T -j 10 -a 4 -h 0.005 -e 10 -d nr
######HIT_SUMMARY
HSP__Pos in Q_________________Subject__________________from species_______Pos in S___E-value___
1 1 .. 135 AAN62354.1|AF506028_23 CTV.22 [Poncirus Poncirus trifol 28 .. 162 E= 3.0e-58
1 1 .. 104 AAN62347.1|AF506028_14 CTV.20 [Poncirus Poncirus trifol 8 .. 101 E= 6.0e-32
1 1 .. 135 NP_173030.1| expressed protein [Arabidop Arabidopsis tha 13 .. 141 E= 6.0e-29
1 1 .. 135 B86292 F7H2. ...
http://mendel.imp.ac.at/SEQUENCES/GACKIX/blast_kix/CTV22.psi
-
http://mendel.imp.ac.at/myristate/myrbase/domains/DOM_hmmer_Pfam_0.01_MYRbase0203newpredNR90mg.fa.html
... PF00042 Globin 4 DUF279 PF03357 SNF7 family 4 E1-E2_ATPase PF00122 E1-E2 ATPase 4 PAF-AH_p_II PF03403 Platelet-activating factor acetylhydrolase, plasma/intracellular isoform II 4 CDK5_activator PF03261 Cyclin-dependent kinase 5 activator protein 4 DnaJ PF00226 DnaJ domain 4 ... 2 Kelch PF01344 Kelch motif 2 SSXT PF05030 SSXT protein (N-terminal region) 2 Ca_channel_B PF00774 Dihydropyridine sensitive L-type calcium channel (Beta subunit) 2 DUF622 PF04822 Protein of unknown function, DUF622 2 laminin_G PF00054 Laminin G domain 2 ... 2 ABC_membrane PF00664 ABC transporter transmembrane region 2 myb_DNA-binding PF00249 Myb-like DNA-binding domain 2 GTP_EFTU PF00009 Elongation ...
http://mendel.imp.ac.at/myristate/myrbase/domains/DOM_hmmer_Pfam_0.01_MYRbase0203newpredNR90mg.fa.html
-
Publikationen
... for Viral Interleukin-6 as Inhibitors of the vIL-6 - gp130 Interaction. The transcription factor repertoire of Flt3+ hematopoietic stem cells. The transcription factor Interferon regulatory factor-4 controls experimental colitis via T cell derived interleukin-6. The transcription factor NFATc2 controls IL-6-dependent T cell activation in experimental colitis. TLR-ligand induced podosome disassembly is ADAM17 ... and controlled development of mouse dendritic cells from Flt3+ CD11b+ progenitors in vitro. Soluble tumor necrosis factor ...
http://univis.uni-kiel.de/formbot/dsc_3Danew_2Fpub_26dir_3Dmedizi_2Fbioche_2Fzytoki_26ref_3Dpub_26years_3Dall
-
Max-Planck-Institut für Züchtungsforschung, Köln - Wissenschaftliche Publikationen 2005
Max-Planck-Institut für Züchtungsforschung, Köln - Wissenschaftliche Publikationen 2005 STARTSEITE Kontakt Stellenangebote Links Sitemap Impressum English Schnellzugriff Anfahrt Bibliothek Öffentlichkeitsarbeit Pressemitteilungen Seminare Über das Institut Forschung Forschungs- highlights News und Seminare Berichte und Publikationen Öffentlichkeits- arbeit, Führungen Services Doktoranden und IMPRS MPIZAlumni Intranet Wissenschafts- Scheune Wissenschaftliche Publikationen Wissenschaftliche Publikationen 2005 Wissenschaftliche Publikationen 2005 Wissenschaftliche Publikationen 2005 Alonso-Blanco, C., C. Gomez-Mena, F. Llorente, M. Koornneef, J. Salinas and J. M. Martinez-Zapater : Genetic and molecular analyses of natural variation indicate CBF2 as a candidate gene for underlying ...
http://www.mpiz-koeln.mpg.de/Berichte_und_Publikationen/Wissenschaftliche_Publikationen/Wissenschaftliche_Publikationen_2005/index.html
-
Cholesterol & Atherosclerosis ? the Artery Connection: Understanding Atherosclerosis (Sponsored)
... in early adulthood and gets worse over time. While LDL cholesterol is a major health factor, here are a few other factors that can contribute to the progression of athero ... the progression of atherosclerosis. Talk with your doctor about it and ask if CRESTOR ® (rosuvastatin calcium) is right for you. Next Article: Cholesterol & Atherosclerosis - the Artery Connection Managing Cholesterol Understanding Atherosclerosis ...
http://www.webmd.com/cholesterol-athero-artery-connection/understanding-atherosclerosis
-
Publikationen
Publikationen Informationssystem der Universität Kiel © Config eG Home | Kontakt | Hilfe Suche: Personen Einrichtungen sonstige Einträge Lehrveranstaltungen Räume Publikationen Forschungsprojekte Veranstaltungskalender Mehrsprachigkeit befindet sich im Aufbau. Robots Forschungsberichte Publikationen Klinik für Allgemeine Pädiatrie 2007 A treatment protocol for infants younger than 1 year with acute lymphoblastic leukaemia (Interfant-99): an observational study and a multicentre randomised trial. Almost normal cognitive function in patients during therapy for childhood acute lymphoblastic leukemia without cranial irradiation according to ALL-BFM 95 and COALL 06-97 protocols: results ...
http://www.univis.uni-kiel.de/formbot/dsc_3Danew_2Fpub_26dir_3Dklinik_2Fklinik_4_26ref_3Dpub_26years_3Dall
-
Igneous Rocks
... magma and rocks (Basaltic) Dark colored Silica/Oxygen: 45% to 52% High in iron, magnesium, calcium Low in (or don't have) potassium, aluminum, sodium Low volatile content High temperature (>1000 deg. C.) Low ... and rocks Dark colored Silica/Oxygen: <45% Very high in iron, magnesium Small amounts of aluminum, calcium Generally don't have sodium, potassium Essentially olivine and pyroxene - little or no plagioclase feldspar Very low volatile ... rock Can melt and add new materials to the melt Texture: the other ...
http://www.jersey.uoregon.edu/~mstrick/geology/Geo_Lectures/Igneous.html
-
Rugged Plants Struggle to Survive on Barren Serpentine Soil
... barren of vital elements needed to support conventional plant life. They are shallow, low in calcium, high in magnesium, and do not hold water well. Serpentine flora provide an exciting opportunity for ... is barium. Adaptation to the toxic influences of barium may be a key factor for flora that exist on serpentine soils. Toxins and growth inhibitors drive natural selection by favoring ... make serpentine soils so infertile: their high magnesium, nickel, and chromium contents, low levels of soluble ...
http://www.mdia.org/Serpentine%20Soil.htm
-
IMBA - 2008
... Kitazawa, J., Takayanagi, H., Penninger, JM., Matsumoto, M., Nitta, T., Takahama, Y., Inoue, J. (2008). The tumor necrosis factor family receptors RANK and CD40 cooperatively establish the thymic medullary microenvironment and self-tolerance ... F. (2008). Experimental testing of predicted myristoylation targets involved in asymmetric cell division and calcium-dependent signalling. Cell Cycle. 7(23):3709-19 ( abstract ) Block, J., Stradal, TE., Hänisch, J., Geffers, R., Köstler, SA., Urban ... L., Wagner, EF. (2008). Development of pulmonary fibrosis through a pathway involving the transcription ...
http://www.imba.oeaw.ac.at/research/imba-publications/2008/
-
Abteilung Lebensmittelwissenschaft | CAU Kiel
... genotype it is associated with increased morbidity and mortality, and represents a significant risk factor for cardiovascular disease, late-onset Alzheimer's disease and other chronic disorders. ApoE is an important ...
http://www.foodsci.uni-kiel.de/text/forschung_themen.htm
-
WHAT IS PLANT NUTRITION?
... as soils do, but the addition of fertilizers or nutrients are different. Many soilless mixes have calcium, magnesium, phosphorus, sulfur, nitrogen, potassium and some micronutrients incorporated as a pre-plant fertilizer. Nitrogen and ... the growing medium to hold exchangeable mineral elements within its structure. These cations include ammonium nitrogen, potassium, calcium, magnesium, iron, manganese, zinc and copper. Peat moss and mixes containing bark, sawdust and other ... hormones, chlorophyll, vitamins and enzymes essential for plant life. Nitrogen metabolism is a major ...
http://retirees.uwaterloo.ca/~jerry/orchids/nutri.html
-
Olympus Microscopy Resource Center: Specialized Microscopy Techniques - Laser Systems for Optical Mi
Olympus Microscopy Resource Center: Specialized Microscopy Techniques - Laser Systems for Optical Microscopy Interactive Tutorials Virtual Microscopy Movie Gallery Downloads Galleries Microscopy Primer Light and Color Basic Concepts Special Techniques Fluorescence Confocal Microscopy Digital Imaging Photomicrography Web Resources MIC-D Microscope Resource Center Laser Systems for Optical Microscopy The lasers commonly employed in optical microscopy are high-intensity monochromatic light sources, which are useful as tools for a variety of techniques including optical trapping, lifetime imaging studies, photobleaching recovery, and total internal reflection ...
http://www.olympusmicro.com/primer/techniques/microscopylasers.html
-
http://www.biomedcentral.com/content/pdf/1471-2164-10-319.pdf
This Provisional PDF corresponds to the article as it appeared upon acceptance. Fully formatted
PDF and full text (HTML) versions will be made available soon.
Gene expression patterns in heterozygous Plk4 murine embryonic fibroblasts
BMC Genomics 2009, 10:319 doi:10.1186/1471-2164-10-319
Alan Morettin (morettia@uwindsor.ca)
Alejandra Ward (vallej1@uwindsor.ca)
Jordan Nantais (nantaiy@uwindsor.ca)
John W Hudson (jhudson@uwindsor.ca)
ISSN 1471-2164
Article type Research article
Submission date 23 October 2008
Acceptance date 16 July 2009
Publication date 16 July 2009
Article URL http:// ...
http://www.biomedcentral.com/content/pdf/1471-2164-10-319.pdf
-
Publikationen
... Observatory (49°N, 16.5°W) Build-up and decline of organic matter during PeECE III Calcium Isotope ( d44/40Ca) Fractionation along Hydrothermal Pathways, Logatchev Field (Mid-Atlantic Ridge, 14°45' N) Calcium isotope fractionation in foraminifera Carbon monoxide emissions by phytoplankton off the Mauritanian coast CarboSchools: Regional project ... Upwelling off Mauritania Contributions of Oxygen Minimum Zone Waters to the Upwellingoff Mauritania Controls on Calcium Isotope Fractionation in Cultured Foraminifera Controls on methane fluxes and their climatic relevance in marine ...
http://univis.uni-kiel.de/formbot/dsc_3Danew_2Fpub_26dir_3Dangegl_2Fleibni_2Fforsch_1_26ref_3Dpub_26years_3Dall